PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P29230_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 204aa    MW: 23318.2 Da    PI: 7.7656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P29230_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.3e-191865148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+ll++ v+++Ggg+W+++++  g++R++k+c++rw +yl
  GSMUA_Achr4P29230_001 18 KGPWTPQEDKLLAEHVNLHGGGRWNSVSKLTGLRRSGKSCRLRWVNYL 65
                           79********************************************97 PP

2Myb_DNA-binding53.94.1e-1771115147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ T+eE+ +++++++ +G++ W++Iar ++ gRt++++k++w+++
  GSMUA_Achr4P29230_001  71 RGKITPEEESIILELHASWGNR-WSAIARSLP-GRTDNDIKNYWRTH 115
                            8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2171365IPR017930Myb domain
SuperFamilySSF466893.74E-3015112IPR009057Homeodomain-like
SMARTSM007176.9E-151767IPR001005SANT/Myb domain
PfamPF002494.2E-181865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-231972IPR009057Homeodomain-like
CDDcd001673.14E-112065No hitNo description
PROSITE profilePS5129425.39666120IPR017930Myb domain
SMARTSM007171.8E-1670118IPR001005SANT/Myb domain
PfamPF002492.0E-1571115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2573119IPR009057Homeodomain-like
CDDcd001671.60E-1175116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MDGEPNRGAD AVEDRWRKGP WTPQEDKLLA EHVNLHGGGR WNSVSKLTGL RRSGKSCRLR  60
WVNYLRPDLK RGKITPEEES IILELHASWG NRWSAIARSL PGRTDNDIKN YWRTHFKKST  120
SPSKNNVEKK PKAQLLTQQQ DEEMRMTMTM NEVERVAVAH DMQQEMAYVY PFTGMLQGGS  180
PDGSISDGSS EEEVSWGGLW HLDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2661207128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397627.11e-142PREDICTED: transcription factor MYB59-like
SwissprotQ4JL841e-51MYB59_ARATH; Transcription factor MYB59
TrEMBLM0ST351e-151M0ST35_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P29230_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-69myb domain protein 79